My review of gluten-free products, restaurants and recipes. Also, making up a few of my own dishes along the way (hopefully without dire results). Really, I created this blog to do my two favorite things, writing and eating. Tweets by @thegfdom!function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs");Tumblr (3.0; @theglutenfreedom)http://theglutenfreedom.tumblr.com/<img src="http://25.media.tumblr.com/20bc44ab2cd40b03ef83ed72cc3cb339/tumblr_monyonIvdi1rq7hv3o1_500.jpg"/><br/><br/><p>Roasted veggies and a raw buckwheat cracker with smashed avocado. Pre workout plant based fuel. #fitness #healthy #glutenfree #vegan #vegetarian #macros #mma #training #jiujitsu #cleaneats #carbs #bodybuilding #motivation #exercise #rawfood @akiracorassani @brendanbrazier</p>http://theglutenfreedom.tumblr.com/post/53394829986http://theglutenfreedom.tumblr.com/post/53394829986Wed, 19 Jun 2013 16:31:35 -0700carbstrainingglutenfreehealthyvegetarianjiujitsuveganmacrosexercisefitnessbodybuildingcleaneatsmmamotivationrawfood<img src="http://25.media.tumblr.com/4c82d05366515f27fc8a9d1a5677f0d0/tumblr_molurxOWdL1rq7hv3o1_500.jpg"/><br/><br/><p>The only time I enjoy candy is when I get to CRUSH it!! #glutenfree #fitness #healthy #motivation #mma #macros #training #vegan #exercise #cleaneats</p>http://theglutenfreedom.tumblr.com/post/53299864193http://theglutenfreedom.tumblr.com/post/53299864193Tue, 18 Jun 2013 13:11:56 -0700motivationglutenfreehealthytrainingveganmacrosfitnesscleaneatsmmaexercise<img src="http://25.media.tumblr.com/21436e728ab3e4705a134ce06bbaf660/tumblr_moig6tTeiU1rq7hv3o1_500.jpg"/><br/><br/><p>Going to watch the new Superman and packed some snacks ‘cause that movie is like 12 hours long. #healthy #fitness #vegan #vegetarian #training #motivation #mma #macros #weekend #cleaneats #leangains #bodybuilding #iifym #rawfood</p>http://theglutenfreedom.tumblr.com/post/53152436869http://theglutenfreedom.tumblr.com/post/53152436869Sun, 16 Jun 2013 17:04:04 -0700motivationleangainshealthyweekendvegetariantrainingveganmacrosiifymrawfoodfitnessbodybuildingcleaneatsmma<img src="http://25.media.tumblr.com/df96be24c26af91640acac7ea2f1900a/tumblr_mof1jpcjcp1rq7hv3o1_500.jpg"/><br/><br/><p>I organized my gluten free flours… on a Friday night. Ah, the perks of having to work over the weekend. #glutenfree #fitness #healthy #vegan #vegetarian #macros #leangains #cleaneats #weekend #exercise #training #motivation</p>http://theglutenfreedom.tumblr.com/post/52998420345http://theglutenfreedom.tumblr.com/post/52998420345Fri, 14 Jun 2013 20:55:01 -0700trainingglutenfreehealthyvegetarianmotivationveganmacrosleangainsfitnesscleaneatsweekendexercise<img src="http://25.media.tumblr.com/c44981658012ff2f40eadfd6b52395b1/tumblr_mo8ewnCZBO1rq7hv3o1_500.jpg"/><br/><br/><p>This is what heaven looks like. Peanut butter rice cake. #protein #exercise #training #iifym #fitness #foodporn #glutenfree #healthy #mma #macros #leangains #carbs #vegan #vancouver #veganathlete #bodybuilding</p>http://theglutenfreedom.tumblr.com/post/52707403907http://theglutenfreedom.tumblr.com/post/52707403907Tue, 11 Jun 2013 07:00:23 -0700trainingfoodpornhealthyglutenfreecarbsveganveganathletemacrosleangainsiifymvancouverfitnessbodybuildingproteinmmaexercise<img src="http://24.media.tumblr.com/905371cfb6a43eeb97c94b13c43dff64/tumblr_mo564iwuaR1rq7hv3o1_500.jpg"/><br/><br/><p>Barbecue season, baby!!! #barbecue #fitness #healthy #vegan #vegetarian #bodybuilding #mma #training #motivation #glutenfree #cleaneats #weekend #veganathlete</p>http://theglutenfreedom.tumblr.com/post/52567923908http://theglutenfreedom.tumblr.com/post/52567923908Sun, 09 Jun 2013 12:57:54 -0700trainingglutenfreehealthyweekendvegetarianmotivationveganveganathletefitnessbodybuildingbarbecuecleaneatsmma<img src="http://24.media.tumblr.com/cd5ebe9200855be524e7ee12ca159a48/tumblr_mo4426RU6G1rq7hv3o1_500.jpg"/><br/><br/><p>Rockin’ the pink locks today. #glutenfree #healthy #fitness #motivation #training #cleaneats #vegan #veganathlete #vegetarian #leangains #mma #macros #hair #coral #nosering #pink</p>http://theglutenfreedom.tumblr.com/post/52523982017http://theglutenfreedom.tumblr.com/post/52523982017Sat, 08 Jun 2013 23:15:42 -0700pinkmotivationglutenfreehealthymacrosvegetariantrainingveganhairveganathleteleangainsfitnesscleaneatsmmacoralnosering<img src="http://25.media.tumblr.com/43258b1b225b917c252781705d76019e/tumblr_mo34dyAg3e1rq7hv3o1_500.jpg"/><br/><br/><p>Automatic sprouting kit I picked up at a garage sale. And a bag o’ seeds included. #vega #vegan #vegetarian #protein #cleaneats #glutenfree #healthy #fitness #mma #training #motivation #rawfood #veganathlete</p>http://theglutenfreedom.tumblr.com/post/52472811546http://theglutenfreedom.tumblr.com/post/52472811546Sat, 08 Jun 2013 10:25:10 -0700trainingglutenfreehealthyvegetarianmotivationveganveganathletevegarawfoodfitnessproteincleaneatsmma<img src="http://24.media.tumblr.com/9cb0d4ddc86cafc4f81e909bebd637c4/tumblr_mo3483IeRg1rq7hv3o1_500.jpg"/><br/><br/><p>My new foldable bike I got at a garage sale! What a steal! #fitness #healthy #training #motivation</p>http://theglutenfreedom.tumblr.com/post/52472580497http://theglutenfreedom.tumblr.com/post/52472580497Sat, 08 Jun 2013 10:21:39 -0700healthytrainingmotivationfitness<img src="http://24.media.tumblr.com/b6dc6d08b8fb173317cb740380e8e0b0/tumblr_mo1wose0sw1rq7hv3o1_500.jpg"/><br/><br/><p>Mexican rice bowl- brown rice, sautéed black beans with veggies, crushed walnuts, homemade salsa and avo! #vegan #vegetarian #mma #macros #protein #healthy #fitness #motivation #training #veganathlete #glutenfree #cleaneats @brendanbrazier</p>http://theglutenfreedom.tumblr.com/post/52424511182http://theglutenfreedom.tumblr.com/post/52424511182Fri, 07 Jun 2013 18:41:15 -0700motivationglutenfreehealthyvegetariantrainingveganveganathletemacrosfitnessproteincleaneatsmma<img src="http://24.media.tumblr.com/0172fb15df7c0e18df45bd7adb4d2f4d/tumblr_mo1wkaBAJj1rq7hv3o1_500.jpg"/><br/><br/><p>Mexican rice bowl night!! Brown rice, homemade salsa, black beans and veggies, crushed walnuts, cheese and avocado. There was ground beef too for the ‘rents but it messed with my picture. #vegan #vegetarian #protein #cleaneats #glutenfree #healthy #weekend #veganathlete #bodybuilding #fitness #foodporn</p>http://theglutenfreedom.tumblr.com/post/52424316941http://theglutenfreedom.tumblr.com/post/52424316941Fri, 07 Jun 2013 18:38:34 -0700glutenfreehealthyvegetarianfoodpornveganveganathletefitnessbodybuildingproteincleaneatsweekend<img src="http://24.media.tumblr.com/6d036c28dd7520850ce11069ea796127/tumblr_mo1ezz3ypt1rq7hv3o1_500.jpg"/><br/><br/><p>Lunch in the sun. Homemade kale chips, hummus and yam fries with celery and carrots. #training #protein #fitness #glutenfree #healthy #cleaneats #vegan #vegetarian #veganathlete #bodybuilding #mma #macros</p>http://theglutenfreedom.tumblr.com/post/52397587638http://theglutenfreedom.tumblr.com/post/52397587638Fri, 07 Jun 2013 12:19:11 -0700trainingglutenfreehealthymacrosvegetarianveganveganathletefitnessbodybuildingproteincleaneatsmma<img src="http://25.media.tumblr.com/a23acc03a000acbd92b43f9caf755781/tumblr_mnzp8bzVy51rq7hv3o1_500.jpg"/><br/><br/><p>My version of plane food: a selection of salads from Whole Foods. The guy next to me was like “What the heck is that? It looks too healthy”. I love people, they make me lol. #vegan #vega #vegetarian #protein #macros #mma #fitness #healthy #motivation #bodybuilding #vancouver #veganathlete #cleaneats #glutenfree #training</p>http://theglutenfreedom.tumblr.com/post/52325415982http://theglutenfreedom.tumblr.com/post/52325415982Thu, 06 Jun 2013 14:04:58 -0700motivationglutenfreehealthyvegetarianveganathleteveganmacrosvegavancouverfitnessbodybuildingtrainingproteincleaneatsmma<img src="http://24.media.tumblr.com/172736a1663e2bb9ae524c571d4b2c26/tumblr_mnwidr3F9x1rq7hv3o1_500.jpg"/><br/><br/><p>Post Muay Thai snack attack. I love foods that take a long time to eat. A little fact about me for the day :) #vancouver #vegan #vegetarian #protein #cleaneats #bodybuilding #mma #macros #veganathlete #training #fitness #glutenfree #healthy #motivation</p>http://theglutenfreedom.tumblr.com/post/52194963837http://theglutenfreedom.tumblr.com/post/52194963837Tue, 04 Jun 2013 20:44:15 -0700trainingglutenfreeveganathletevegetarianmotivationveganmacrosvancouverfitnessbodybuildingproteincleaneatsmmahealthy<img src="http://25.media.tumblr.com/c12c0fe18c9143527be2252717a6cc0c/tumblr_mnje9nAopX1rq7hv3o1_500.jpg"/><br/><br/><p>Get stuffed…pepper. Brown rice and veggies all spiced up and broiled. Good eats. #carbs #bodybuilding #detox #cleaneats #fitness #foodporn #glutenfree #healthy #iifym #leangains #mma #macros #motivation #protein #training #vegan #vegetarian</p>http://theglutenfreedom.tumblr.com/post/51607661279http://theglutenfreedom.tumblr.com/post/51607661279Tue, 28 May 2013 18:46:35 -0700carbscleaneatsfoodpornhealthymacrosvegetarianglutenfreemotivationveganleangainsiifymfitnessbodybuildingtrainingproteindetoxmma<img src="http://25.media.tumblr.com/38043edf0f2cd7108f2ad7c747aca35e/tumblr_mnh29tUCWW1rq7hv3o1_500.jpg"/><br/><br/><p>Moroccan inspired quinoa and chickpeas. Sautéed red pepper, zucchini, shallots and carrot with fresh mint. And the sauce, oh my god, the sauce. Almond butter, lemon juice, olive oil, cinnamon, apple cider vinegar and plain almond milk- I could have just eaten the sauce on its own. This dish would also be fantastic with lamb. #vegan #vegetarian #training #mma #macros #glutenfree #protein #healthy #fitness #bodybuilding #detox #carbs #training #iifym #leangains</p>http://theglutenfreedom.tumblr.com/post/51495175979http://theglutenfreedom.tumblr.com/post/51495175979Mon, 27 May 2013 12:32:17 -0700trainingglutenfreehealthyvegetariancarbsveganmacrosleangainsiifymfitnessbodybuildingproteindetoxmma<img src="http://24.media.tumblr.com/880490e5a1d707836933f26cc7be7b58/tumblr_mngr8dLyt61rq7hv3o1_500.jpg"/><br/><br/><p>Haven’t posted in awhile because I’ve been working some crazy hours and ended up surviving off of Whole Foods salads. Finally got to sit down and enjoy my breakfast. Steel cut oats, hemp seeds, blackberries and cinnamon. Now I shall proceed to mash it altogether. #healthy #detox #fitness #vegan #vegetarian #bodybuilding #training #motivation #mma #macros #leangains #carbs #glutenfree #iifym</p>http://theglutenfreedom.tumblr.com/post/51478305546http://theglutenfreedom.tumblr.com/post/51478305546Mon, 27 May 2013 08:33:49 -0700carbstrainingleangainshealthyvegetarianglutenfreemotivationveganmacrosiifymfitnessbodybuildingdetoxmma<img src="http://25.media.tumblr.com/31014b16b6f4d23850d57663fba7ab88/tumblr_mn2dv97Ibc1rq7hv3o1_500.jpg"/><br/><br/><p>Me and the sweetest puppy ever. I wanted to nibble on him. #puppy #adorable #cute #stealinghim</p>http://theglutenfreedom.tumblr.com/post/50851828495http://theglutenfreedom.tumblr.com/post/50851828495Sun, 19 May 2013 14:18:44 -0700cutestealinghimpuppyadorable<img src="http://25.media.tumblr.com/c3cdde35e6e6df1da6ceab07edbf05f2/tumblr_mmyb7pLgaE1rq7hv3o1_500.jpg"/><br/><br/><p>I was getting jealous of everyone’s Jimmy John’s unwiches so I made my own. Then I rolled it up like a boss. #lowcarb #keto #lchf #macros #mma #protein #motivation #training #fitness #healthy #bodybuilding #foodporn #glutenfree</p>http://theglutenfreedom.tumblr.com/post/50658987795http://theglutenfreedom.tumblr.com/post/50658987795Fri, 17 May 2013 09:31:01 -0700motivationketofoodpornhealthyglutenfreetrainingmacroslchffitnessbodybuildinglowcarbproteinmma<img src="http://24.media.tumblr.com/32ef0b6dc9c6b4590696b8322e381d20/tumblr_mmpqfkKcvY1rq7hv3o1_500.jpg"/><br/><br/><p>Keto pizza, whaddup!! The crust was originally going to be a lid for a traditional Québécois meat pie known as a Tourtière but my man forgot to unthaw the meat and I was hungry. Damn that was a long sentence. Thanks to @anabolickandy for the crust idea- it was your chicken pot pie topper. #keto #lowcarb #leangains #primal #bodybuilding #crossfit #mma #macros #fitness #foodporn #glutenfree #healthy #training #iifym #protein @lowcarb_ella</p>http://theglutenfreedom.tumblr.com/post/50306815603http://theglutenfreedom.tumblr.com/post/50306815603Sun, 12 May 2013 18:21:20 -0700trainingketocrossfitmacroshealthyprimalfoodpornleangainsiifymfitnessbodybuildinglowcarbproteinmmaglutenfree